F.1. TeX messages
! Missing control sequence inserted.
Please dont say
‘\def cs{...}’,
say
‘\def\cs{...}’.
I’ve inserted an inaccessible
control sequence so that your definition will be completed without mixing me up too badly.
You can recover graciously from this error, if you’re careful; see exercise 27.2in The TeXbook.
! Missing delimeter(. inserted).
Iwas expecting to see something like
‘(’
or
‘\{’
or
‘\}’
here. If you typed, e.g.,
‘{’
insteadof
‘\{’
you shouldprobably deletethe
‘{’
bytyping‘1’now, so that braces don’t get
unbalanced. Otherwise just proceed. Acceptable delimeters are characters whose
\delcode
is nonnegative, or you can use ‘
\delimeter
<delimeter code>’.
! Missing number, treated as zero.
Anumber should have been here; I inserted ‘0’. (If you can’t figure out why I needed to see a
number, look up ‘weird error’ in the index to The TeXbook.)
In LaTeX this is often caused by a command expecting a number or a length argu-
ment but not finding it. You might have forgottenthe argument or an opening square
bracket in the text might have been taken as the start of an optional argument. For
example, the
\\
(newline) command takes an optional length argument, so the fol-
lowing will produce this error:
... next line\\
[Horatio:] ...
! Not a letter.
Letters in
\hyphenation
words must have
\lccode
>0.
One or more characters in the argument to the
\hyphenation
command should not
be there.
! Number too big.
Ican only go up to 2147483647 = ’17777777777 = "7FFFFFFF, so I’m using that number
instead of yours.
These all represent the same value, firstly in decimal, secondly in octal, and lastly in
hexadecimal notations.
! Output loop–- ...consecutive dead cycles.
I’ve concluded that your
\output
is awry; it never does a
\shipout
, so I’m shipping
\box255
out myself. Next time increase
\maxdeadcycles
if you want me to be more
patient!
TeX appears to be spinning its wheels, doing nothing.
! Overfull \hbox (...pt too wide).
This is a warning that TeX couldn’t cram some text into the alloted horizontal space.
! Overfull \vbox (...pt too high).
This is a warning that TeX couldn’t find a good place for a pagebreak, so it has put
too much onto the current page.
453
Convert pdf document to text - control Library utility:C# PDF Convert to Text SDK: Convert PDF to txt files in C#.net, ASP.NET MVC, WinForms, WPF application
C# PDF to Text (TXT) Converting Library to Convert PDF to Text
www.rasteredge.com
Convert pdf document to text - control Library utility:VB.NET PDF Convert to Text SDK: Convert PDF to txt files in vb.net, ASP.NET MVC, WinForms, WPF application
VB.NET Guide and Sample Codes to Convert PDF to Text in .NET Project
www.rasteredge.com
F. T
HE TERRORS OF ERRORS
! Paragraph ended before ...was complete.
Isuspect you’ve forgotten a ‘}’, causing me to apply this control sequence to too much text.
Howcan we recover? My plan is to forget the whole thing and hope for the best.
Either a blank line or a
\par
command appeared in the argument to a macro that
cannot handle paragraphs (e.g., a macro that was defined using
\newcommand*
).
! Please type a command or say ‘\end’.
This is the message that causes me the most trouble. My computer always ignores
whatever I say to it and even typing
\end
hasno effect. What I usually do, after hav-
ing tried a few variations like
\end{document}
,is to kill the program by whatever
means the operating system provides. Some other possible responses include:
 Type
\stop
 Type
\csname @@end\endcsname
(LaTeX stores TeX’s version of
\end
as
\@@end
)
 Type some macro that you think is unknown, perhaps
\qwertyuiod
,then re-
spond to the error message:
Undefined control sequence.
 Sometimes nothing works except killing the program. If you are are sure you
know how to kill a program, try the following highly contrived code:
\documentclass{article}
\newif\ifland
\newif\ifprint
\newcommand{\Xor}[2]{\ifx #1 #2}
\begin{document}
% \Xor{\ifland}{\ifprint}% try uncommenting this
\iffalse
\end{document}
! Runaway argument.
or
Runaway definition.
or
Runaway preamble.
or
Runaway text.
! Sorry, but I’m not programmed to handle this case.
I’ll just pretend that you didn’t ask for it. If you’re in the wrong mode, you might be able to
return to the right one by typing ‘I}’ or ‘I$’ or ‘I
\par
’.
! TeX capacity exceeded, sorry [...].
If you absolutely need more capacity, you can ask a wizard to enlarge me.
This is dealt with in more detail below.
! Text line contains an invalid character.
Afunny symbol that I can’t read has just been input. Continue, and I’ll forget that it ever
happened.
The input file contains a nonprinting (control) character; only printing characters
should be inthe file. Some programs, like word processors, insert invisible characters
into their output file. If you have used one of these to prepare your input file, make
sure you save it as a plain text file (also known as an ASCII file).
454
control Library utility:C# PDF Text Extract Library: extract text content from PDF file in
C#.NET PDF text extracting library package, you can easily extract all or partial text content from target PDF document file, edit selected text content, and
www.rasteredge.com
control Library utility:C# PDF Convert to HTML SDK: Convert PDF to html files in C#.net
easy for C# developers to convert and transform style that are included in target PDF document file original formatting and interrelation of text and graphical
www.rasteredge.com
F.1. TeX messages
! That makes 100 errors; please try again.
! This can’t happen (...).
I’m broken. Please show this to someone who can fix can fix
This is the message you should never see!
! Too many }’s.
You’ve closed more groups than you opened. Such booboos are generally harmless, so keep
going.
There are more closing braces (}) than there are opening braces ({).
! Unbalanced output routine.
Your sneaky output routine has fewer real {’s than }’s. I can’t handle that very well; good
luck.
Apackage or classhasdone nasty thingsto one of LaTeX’s most delicate parts — the
output routine.
! Unbalanced write command.
On this page there’s a
\write
withfewer real {’s than }’s. I can’t handle that very well; good
luck.
! Undefined control sequence.
The control sequence at the end of the top line of your error message was never
\def
’ed.
If you have misspelled it (e.g., ‘
\hobx
’), type ‘I’ and the correct spelling (e.g., ‘I
\hbox
’).
Otherwise just continue, and I’ll forget whatever was undefined.
TeX has come across a macro name that it does not know about. Perhaps you mis-
pelled it, or it is defined in a package you did not include. Another possibility is that
you used a macro name that included the
@
character without enclosing it between
\makeatletter
and
\makeother
(see §E.4). In this case TeX would think that the
name was just the portion up to the
@
.
! Underfull \hbox (badness ...).
This is a warning. There might be some extra horizontal space. It could be caused by
trying to use two
\newline
or
\\
commandsin successionwithnothing intervening,
or by using a
\linebreak
command or typesetting with the
\sloppy
declaration.
! Underfull \vbox (badness ...).
This isa warning that TeX couldn’t find a good place for a pagebreak, so it produced
apage with too much whitespace on it.
! Use of ...doesn’t match its definition.
If you say, e.g.,
‘\def\a1{...}’,
then you must always put ‘1’ after ‘
\a
’, since the
control sequence names are made up of letters only. The macro here has not been followed by
the requied stuff, so I’m ignoring it.
! You can’t use ‘...’ in ‘...’.
455
control Library utility:VB.NET PDF Convert to HTML SDK: Convert PDF to html files in vb.
Embed zoom setting (fit page, fit width). Free library for .NET framework. Why do we need to convert PDF document to HTML webpage using VB.NET programming code?
www.rasteredge.com
control Library utility:C# PDF Converter Library SDK to convert PDF to other file formats
need to get text content from PDF file, this C# PDF to text conversion code If you want to transform and convert PDF document to Jpeg image file format, this
www.rasteredge.com
F. T
HE TERRORS OF ERRORS
This often manifests itself in the form
You can’t use ‘\spacefactor’ in vertical mode
the cause is usually trying to use a macro with
@
in its name, typically in the pream-
ble (see §E.4). The solution is to enclose the macro within
\makeatletter
and
\makeatother
.
Another version is
You can’t use ‘macro parameter character #’ in ... mode.
In this case you have used a naked
#
in ordinary text; it can only be used in the
definition of a macro. In ordinary text you have to use
\#
.
F.1.1 TeX capacity exceeded
TeX has run out of computer space before it finished processing your document. The most
likely cause is an error in the input file rather than there really not being enough space
—I have processed documents consisting of more than 1400 pages without any capacity
problems.
You can very easily make TeX run out of space. Try inputting this:
\documentclass{article}
\newcommand*{\fred}{Fred}
% should print ‘Fred’
% try to make it print ‘Frederick’ instead
\renewcommand{\fred}{\fred erick}
\begin{document}
His name is \fred.
\end{document}
and TeX will tell you that it has run out of stack space:
! TeX capacity exceeded, sorry [input stack size=15000].
\fred ->\fred
erick
l.5 His name is \fred
.
No pages of output.
Transcript written on errors.log.
The offending code above tries to define
\fred
in terms of itself, and TeX just keeps
chasing round and round trying to pin down
\fred
until it is exhausted.
At the end of the
log
file for a run, TeX prints the memory space it has used. For
example:
Here is how much of TeX’s memory you used:
2432 strings out of 60985
29447 string characters out of 4940048
106416 words of memory out of 8000001
5453 multiletter control sequences out of 10000+65535
8933 words of font info for 31 fonts out of 1000000 for 1000
276 hyphenation exceptions out of 1000
26i,11n,21p,210b,380s stack positions out of
15000i,4000n,6000p,200000b,40000s
456
control Library utility:VB.NET PDF Text Extract Library: extract text content from PDF
With this advanced PDF Add-On, developers are able to extract target text content from source PDF document and save extracted text to other file formats
www.rasteredge.com
control Library utility:VB.NET PDF Convert to Word SDK: Convert PDF to Word library in vb.
Convert PDF document to DOC and DOCX formats in Visual Basic .NET project. using RasterEdge.XDoc.PDF; Convert PDF to Word Document in VB.NET Demo Code.
www.rasteredge.com
F.1. TeX messages
The eror message says what kind of space it exhausted (input stack size in the example
above). The most common are:
buffer size
Can be caused by too long a section or caption title appearing in the ToC,
LoF, etc. Use the optional argument to produce a shorter entry.
exception dictionary
There are too many wordslisted in
\hyphenation
commands.
Remove any that are not actually used and if that doesn’t work, remove the less
common ones and insert
\-
in the words in the text.
hash size
The document defines too many command names and/or uses too many
cross-referencing
\label
s.
input stack size
Typically caused by a self-referencing macro definition.
main memory size
There are three main things that cause TeX to run out of main mem-
ory:
 Defining a lot of very long complicated macros.
 Having too many
\index
or
\glossary
commands on a page.
 Creating such acomplicated page that TeX cannot hold all it needs to processit.
The solution to the first two problems is to simplify and eliminate. The third is more
problematic.
Large
tabular
s,
array
sand
picture
s(the
\qbezier
command is a memory hog)
can gobble up memory. A queue of floats also demands memory space. Try putting
a
\clearpage
just before the place where the error occurs and if it still runs out of
room then there may be an error in your file, otherwise you did exceed the capacity.
If you have a long paragraph or a long
verbatim
environment try breaking it up,
as TeX keeps these in memory until it is ready to typeset them. If you have a queue
of floats make sure that you have done your best to help LaTeX find a way to out-
put them (see §10.4) and try adding
\clearpage
at appropriate places to flush the
queue.
pool size
Typically caused by having too many charactersincommand names and label
names.
It can also be caused by omitting the right brace that ends the argument of a
counter command (
\setcounter
or
\addtocounter
)or of a
\newenvironment
or
\newtheorem
command.
save stack size
This happens if commands or environments are nested too deeply.
For instance a
picture
that contains a
picture
that includes a
\multiput
that
includes a
picture
that includes a ...
457
control Library utility:VB.NET PDF Convert to Jpeg SDK: Convert PDF to JPEG images in vb.
Convert PDF to Text. Convert PDF to JPEG. Convert PDF to Png, Gif, Bitmap Images. File & Page Process. File: Merge, Append PDF Files. File: Split PDF Document
www.rasteredge.com
control Library utility:VB.NET PDF Convert to Tiff SDK: Convert PDF to tiff images in vb.
VB.NET PDF - Convert PDF to TIFF Using VB in VB.NET. Free VB.NET Guide to Render and Convert PDF Document to TIFF in Visual Basic Class.
www.rasteredge.com
F. T
HE TERRORS OF ERRORS
F.2 L
A
T
E
X
ERRORS
LaTeX errors introduce themselves differently from those that TeX finds. For example, if
you ever happended to use the
\caption
command outside a float, like:
\caption{Naked}
you would get the message:
! LaTeX Error: \caption outside float.
See the LaTeX manual or LaTeX Companion for explanation.
Type H <return> for immediate help.
...
l.624 \caption
{Naked}
?
If you then typed
H
in response you would get the following helpful message:
You’re in trouble here. Try typing <return> to proceed.
If that doesn’t work, type X <return> to quit.
?
The majority of LaTeX’s help messages follow this formula, so I have not noted them in
the alphabetical listing below.
\< in mid line
A
\<
appears in the middle of a line in a
tabbing
environment; it should only come
at the start of a line.
... allowed only in math mode
You have tried to use amath command in a non-math mode.
Bad \line or \vector argument
A
\line
or
\vector
has a negative length argument or the slope is not within the
allowed range.
Bad math environment delimeter
If inmath mode there is astart mathmode command like
\(
or
\[
or if inLR or para-
graphmode there isan end math mode command like
\)
or
\]
.The basic problem is
unmatched math mode delimeters or unbalanced braces.
\begin{...} ended by \end{...}
The name of the
\begin
argument isnot the same as the name of the
\end
argument.
This could be caused by a typo or a missing
\end
.
Can only be used in the preamble
Some commands can only be used in the preamble, such as
\usepackage
,but there
was one of these after the
\begin{document}
.
458
F.2. LaTeX errors
\caption outside float
You have used the
\caption
command outside a float, such as a
figure
or
table
environment.
Command \... already defined or name \end... illegal
This is normally because you have used one of the
\new...
commands to define a
command or environment or counter name that has already been used; remember
also that defining an environment
foo
automatically defines the macro
\foo
.Either
choose anew name or use the appropriate
\renew...
;also, see §19.1. Inthe unlikely
event that you have tried to define something beginning with
\end...
,choose an-
other name.
Command ... invalid in math mode
You have used a non-math command in math mode.
Command ... not provided in base LaTeX2e
You have tried to use a symbol that is not part of basic LaTeX. Try loading thela-
texsymoramsfontspackagewhichmightdefinethesymbol.
Counter too large
You are using a non-numeric counter representation, suchas letters or footnote sym-
bols, and the counter has exceeded the allowed number (for example there are only
26 alphabetic characters).
Environment ... undefined
LaTeX does not know the name of the argument of a
\begin
. You have probably
misspelled it.
File not found. Type X to quit or <RETURN> to proceed or enter new
name (Default extension: ...)
LaTeX cannot find the file you requested. The extension
tex
resultsfrom a problem-
atic
\input
or
\include
;the extension
sty
from a
\usepackage
and an extension
cls
from a
\documentclass
.
Float(s) lost
Usually caused by having too many
\marginpar
son a page.
Illegal character in array argument
There is an illegal character in the argument of an
array
or
tabular
environment,
or in the second argument of a
\multicolumn
command.
\include cannot be nested
Afile that is
\include
dcannot
\include
any other files.
\LoadClass in package file
This is an error in a package file you are using (you can only use
\LoadClass
in a
class file). Complain to the author.
459
F. T
HE TERRORS OF ERRORS
Lonely \item –- perhaps a missing list environment
An
\item
command appears to be outside any list environment.
Missing \begin{document}
If you haven’t forgotten
\begin{document}
then there is something wrong in the
preamble as LaTeX is trying to typeset something before the document starts. This is
often caused by missing the backslash from a command, misplaced braces round an
argument, a stray character, or suchlike.
Missing @-exp in array argument
The
@
character is not followed by an @-expression in the argument of an
array
or
tabular
environment, or in the second argument of a
\multicolumn
command.
Missing p-arg in array argument
There is a
p
not followed by braces in the argument of an
array
or
tabular
envi-
ronment, or in the second argument of a
\multicolumn
command.
No counter ... defined
The argument to a
\setcounter
or
\addtocounter
command, or in the optional
argument to
\newcounter
or
\newtheorem
is not the name of a counter. Perhaps
you misspelled the name. However, if the error occured while an
aux
file was being
read then you might well have used a
\newcounter
in an
\include
dfile.
No room for a new ...
TeX is limited in the numbers of different things it can handle. You might not recog-
nize the thing that the message mentions as some of them are hidden in LaTeX. The
LaTeX
counter
uses a TeX
\count
for example, and a length is a TeX
\skip
.Most
things are limited to a maximum of 256 but there can be no more than 16 files open
for reading and 16 for writing.
No \title given
You did not put a
\title
command before using
\maketitle
.
Not in outer par mode
There is a float (e.g., a
figure
or a
\marginpar
)in math mode or in a parbox (e.g.,
in another float).
Option clash for ...
The same package was used twice but with different options. It is possible for one
package to use another package which might be the cause if you can’t see anything
obvious.
Page height already too large
You are trying to use
\enlargethispage
when the page is already too large.
\pushtabs and \poptabs don’t match
There are unmatched
\pushtabs
and
\poptabs
in a
tabbing
environment.
460
F.2. LaTeX errors
\RequirePackage or \LoadClass in Options Section
This is a problem in a class or package file. Complain to the author.
Something’s wrong –- perhaps a missing \item
This can be caused by not starting a list environment, such as
itemize
with a
\item
command, or by omitting the argument to the
thebibliography
environ-
ment. There are many other non-obvious causes, such as calling some macro that
ends up using
\addvspace
or
\addpenalty
when not in
vmode
.
Suggested extra height (...) dangerously large
LaTeX is concerned that you a trying to increase the page size too much with the
\enlargthispage
command.
Tab overflow
In the
tabbing
environment a
\=
has exceeded LaTeX’s maximum number of tab
stops.
The file needs format ... but this is ...
The document uses a document class or package that is not compatible with the
version of LaTeX you are using. If you are using only standard files then there is a
problem with your LaTeX installation.
There’s no line to end here
A
\newline
or
\\
appears in vertical mode, for example between paragraphs. Or
perhaps you have tried to put
\\
immediately after an
\item
to start the text on a
new line. If this is the case, then try this:
\item \mbox{} \\
...
This may be a LaTeX bug
This is a message you don’t want to see as it is produced by the output routine —
perhaps the most obscure part of LaTeX. It is probably due to an earlier error. If it is
the first error, though, and you can’t see anything wrong, ask for somebody’s help.
Too deeply nested
There are too many list environments nested within each other. At least four levels
are usually available but some list environments are not obvious (for example the
quotation
environment is actually a list).
Too many columns in eqnarray environment
An
eqnarray
environment has three
&
column separators with no
\\
between.
Too many unprocessed floats
There may be too many
\marginpar
sto fit on a page, but it’s more likely that LaTeX
hasn’t been able to find locations for printing all the figures or tables. If one float
cannot be placed, all later ones are saved until LaTeX runs out of storage space. See
§10.4 for details on how LaTeX decides to place a float.
461
F. T
HE TERRORS OF ERRORS
Two \documentclass commands
Your document has two
\documentclass
commands; only one is permitted.
Two \LoadClass commands
This is an error in the class file. Complain to the author.
Undefined tab position
A
\>
,
\+
,
\-
,or
\<
tabbing command is trying to move to atab position that has not
been defined by a
\=
command.
Unknown option ... for class/package ...
You have asked for an optionthat the class or package doesnot know about. Perhaps
you have mispelled something, or omitted a comma.
\usepackage before \documentclass
In general, the
\usepackage
command can only be used in the preamble.
\verb ended by end of line
The argument of a
\verb
command runspast the end of the line. Perhaps you forgot
to put in the correct ending character.
\verb illegal in command argument
A
\verb
cannot be part of the argument to another command.
F.3 L
A
T
E
X
WARNINGS
Most warnings are given at the point in the document where a potential problem is dis-
covered, while others are output after the document has been processed.
For example, the following code
... \ref{joe}... \cite{FRED96} ...
may produce warnings like
Latex Warning: Reference ‘joe’ on page 12 undefined
on input line 881.
Latex Warning: Citation ‘FRED96’ on page 12 undefined
at lines 890--897.
during the document processing, and then at the end there will also be the warning:
LaTeX Warning: There were undefined references.
Some warning messages pinpoint where aproblem might lie, asinthe citationwarning
above, while othersmake no attempt to do so. Inthe alphabeticallisting that follows I have
not included such information, even if it is supplied.
Citation ... on page ... undefined
The key in a
\cite
command was not defined by any
\bibitem
.
462
Documents you may be interested
Documents you may be interested