asp.net mvc 4 and the web api pdf free download : Reader merge pdf Library software component .net winforms asp.net mvc memman49-part1399

F.1. TeXmessages
! Missing g control sequence inserted.
Pleasedontsay
‘\def cs{...}’,
say
‘\def\cs{...}’.
I’veinsertedaninaccessible
controlsequencesothatyourdefinitionwillbecompletedwithoutmixingmeuptoobadly.
Youcanrecovergraciouslyfromthiserror,ifyou’recareful;seeexercise27.2inTheTeXbook.
! Missing g delimeter(. . inserted).
Iwasexpectingtoseesomethinglike
‘(’
or
‘\{’
or
‘\}’
here. Ifyoutyped, , e.g.,
‘{’
insteadof
‘\{’
youshouldprobablydeletethe
‘{’
bytyping‘1’now,sothatbracesdon’tget
unbalanced.Otherwisejustproceed.Acceptabledelimetersarecharacterswhose
\delcode
isnonnegative,oryoucanuse‘
\delimeter
<delimetercode>’.
! Missing g number, treated d as s zero.
Anumbershouldhavebeenhere;Iinserted‘0’.(Ifyoucan’tfigureoutwhyIneededtoseea
number,lookup‘weirderror’intheindextoTheTeXbook.)
InLaTeXthisisoftencausedbyacommandexpectinganumberoralengthargu-
mentbutnotfindingit.Youmighthaveforgottentheargumentoranopeningsquare
bracketinthetextmighthavebeentakenasthestartofanoptionalargument. For
example,the
\\
(newline)commandtakesanoptionallengthargument,sothefol-
lowingwillproducethiserror:
... next t line\\
[Horatio:] ...
! Not t a a letter.
Lettersin
\hyphenation
wordsmusthave
\lccode
>0.
Oneormorecharactersintheargumenttothe
\hyphenation
commandshouldnot
bethere.
! Number r too big.
Icanonlygoupto2147483647=’17777777777="7FFFFFFF,soI’musingthatnumber
insteadofyours.
Theseallrepresentthesamevalue,firstlyindecimal,secondlyinoctal,andlastlyin
hexadecimalnotations.
! Output t loop–- - ...consecutive dead cycles.
I’veconcludedthatyour
\output
isawry; itnever r does a
\shipout
, soI’mshipping
\box255
outmyself. Nexttimeincrease
\maxdeadcycles
ifyouwantmetobemore
patient!
TeXappearstobespinningitswheels,doingnothing.
! Overfull l \hbox x (...pt too wide).
ThisisawarningthatTeXcouldn’tcramsometextintotheallotedhorizontalspace.
! Overfull l \vbox x (...pt too high).
ThisisawarningthatTeXcouldn’tfindagoodplaceforapagebreak,soithasput
toomuchontothecurrentpage.
453
Reader merge pdf - Merge, append PDF files in C#.net, ASP.NET, MVC, Ajax, WinForms, WPF
Provide C# Demo Codes for Merging and Appending PDF Document
batch combine pdf; merge pdf files
Reader merge pdf - VB.NET PDF File Merge Library: Merge, append PDF files in vb.net, ASP.NET, MVC, Ajax, WinForms, WPF
VB.NET Guide and Sample Codes to Merge PDF Documents in .NET Project
pdf merge documents; acrobat merge pdf files
F. T
HE TERRORSOFERRORS
! Paragraph h ended before ...was complete.
Isuspectyou’veforgottena‘}’,causingmetoapplythiscontrolsequencetotoomuchtext.
Howcanwerecover?Myplanistoforgetthewholethingandhopeforthebest.
Eitherablanklineora
\par
commandappearedintheargumenttoamacrothat
cannothandleparagraphs(e.g.,amacrothatwasdefinedusing
\newcommand*
).
! Please e type a a command d or r say ‘\end’.
Thisisthemessagethatcausesmethemosttrouble. Mycomputeralwaysignores
whateverIsaytoitandeventyping
\end
hasnoeffect.WhatIusuallydo,afterhav-
ingtriedafewvariationslike
\end{document}
,istokilltheprogrambywhatever
meanstheoperatingsystemprovides.Someotherpossibleresponsesinclude:
 Type
\stop
 Type
\csname @@end\endcsname
(LaTeX stores s TeX’s version n of
\end
as
\@@end
)
 Typesomemacrothatyouthinkisunknown,perhaps
\qwertyuiod
,thenre-
spondtotheerrormessage:
Undefined control l sequence.
 Sometimesnothingworksexceptkillingtheprogram. Ifyouarearesureyou
knowhowtokillaprogram,trythefollowinghighlycontrivedcode:
\documentclass{article}
\newif\ifland
\newif\ifprint
\newcommand{\Xor}[2]{\ifx #1 #2}
\begin{document}
% \Xor{\ifland}{\ifprint}% % try y uncommenting this
\iffalse
\end{document}
! Runaway y argument.
or
Runaway definition.
or
Runaway preamble.
or
Runaway text.
! Sorry, , but t I’m not programmed to handle this case.
I’lljustpretendthatyoudidn’taskforit.Ifyou’reinthewrongmode,youmightbeableto
returntotherightonebytyping‘I}’or‘I$’or‘I
\par
’.
! TeX X capacity exceeded, sorry [...].
Ifyouabsolutelyneedmorecapacity,youcanaskawizardtoenlargeme.
Thisisdealtwithinmoredetailbelow.
! Text t line contains an n invalid d character.
AfunnysymbolthatIcan’treadhasjustbeeninput. Continue,andI’llforgetthatitever
happened.
The input filecontainsanonprinting(control)character; ; onlyprintingcharacters
shouldbeinthefile.Someprograms,likewordprocessors,insertinvisiblecharacters
intotheiroutputfile.Ifyouhaveusedoneofthesetoprepareyourinputfile,make
sureyousaveitasaplaintextfile(alsoknownasanASCIIfile).
454
XImage.Barcode Scanner for .NET, Read, Scan and Recognize barcode
VB.NET File: Merge PDF; VB.NET File: Split PDF; VB.NET VB.NET Annotate: PDF Markup & Drawing. XDoc.Word for C#; C#; XImage.OCR for C#; XImage.Barcode Reader for C#
pdf combine files online; acrobat combine pdf
C# Imaging - Scan Barcode Image in C#.NET
RasterEdge Barcode Reader DLL add-in enables developers to add barcode image recognition & barcode types, such as Code 128, EAN-13, QR Code, PDF-417, etc.
merge pdf online; acrobat merge pdf
F.1. TeXmessages
! That t makes 100 errors; please try y again.
! This s can’t happen (...).
I’mbroken.Pleaseshowthistosomeonewhocanfixcanfix
Thisisthemessageyoushouldneversee!
! Too o many }’s.
You’veclosedmoregroupsthanyouopened. Suchbooboosaregenerallyharmless,sokeep
going.
Therearemoreclosingbraces(})thanthereareopeningbraces({).
! Unbalanced d output routine.
Yoursneakyoutputroutinehasfewerreal{’sthan}’s. Ican’thandlethatverywell;good
luck.
ApackageorclasshasdonenastythingstooneofLaTeX’smostdelicateparts—the
outputroutine.
! Unbalanced d write command.
Onthispagethere’sa
\write
withfewerreal{’sthan}’s.Ican’thandlethatverywell;good
luck.
! Undefined d control sequence.
Thecontrolsequenceattheendofthetoplineofyourerrormessagewasnever
\def
’ed.
Ifyouhavemisspelledit(e.g.,‘
\hobx
’),type‘I’andthecorrectspelling(e.g.,‘I
\hbox
’).
Otherwisejustcontinue,andI’llforgetwhateverwasundefined.
TeXhascomeacrossamacronamethatitdoesnotknowabout. Perhapsyoumis-
pelledit,oritisdefinedinapackageyoudidnotinclude.Anotherpossibilityisthat
youusedamacronamethatincludedthe
@
characterwithoutenclosingitbetween
\makeatletter
and
\makeother
(see§E.4). InthiscaseTeXwouldthinkthatthe
namewasjusttheportionuptothe
@
.
! Underfull l \hbox (badness ...).
Thisisawarning.Theremightbesomeextrahorizontalspace.Itcouldbecausedby
tryingtousetwo
\newline
or
\\
commandsinsuccessionwithnothingintervening,
orbyusinga
\linebreak
commandortypesettingwiththe
\sloppy
declaration.
! Underfull l \vbox (badness ...).
ThisisawarningthatTeXcouldn’tfindagoodplaceforapagebreak,soitproduced
apagewithtoomuchwhitespaceonit.
! Use e of f ...doesn’t match h its s definition.
Ifyousay, e.g.,
‘\def\a1{...}’,
thenyoumustalwaysput‘1’after‘
\a
’, since the
controlsequencenamesaremadeupoflettersonly.Themacroherehasnotbeenfollowedby
therequiedstuff,soI’mignoringit.
! You u can’t t use e ‘...’ ’ in n ‘...’.
455
C# PDF: PDF Document Viewer & Reader SDK for Windows Forms
On this page, besides brief introduction to RasterEdge C#.NET PDF document viewer & reader for Windows Forms application, you can also see the following aspects
add two pdf files together; scan multiple pages into one pdf
.NET PDF Document Viewing, Annotation, Conversion & Processing
File & Page Process. Create new file, load PDF from existing files. Merge, split PDF files. Insert, delete PDF pages. Re-order, rotate PDF pages. PDF Read.
add pdf pages together; reader create pdf multiple files
F. T
HE TERRORSOFERRORS
Thisoftenmanifestsitselfintheform
You can’t t use e ‘\spacefactor’ ’ in n vertical l mode
thecauseisusuallytryingtouseamacrowith
@
initsname,typicallyinthepream-
ble (see §E.4). . The e solutionisto enclose the macrowithin
\makeatletter
and
\makeatother
.
Anotherversionis
You can’t t use e ‘macro o parameter character #’ in n ... . mode.
Inthiscaseyouhaveusedanaked
#
inordinarytext; itcanonlybeusedinthe
definitionofamacro.Inordinarytextyouhavetouse
\#
.
F.1.1 TeXcapacityexceeded
TeXhasrunoutofcomputerspacebeforeitfinishedprocessingyourdocument.Themost
likelycauseisanerrorintheinputfileratherthantherereallynotbeingenoughspace
—Ihaveprocesseddocumentsconsistingofmorethan1400pageswithoutanycapacity
problems.
YoucanveryeasilymakeTeXrunoutofspace.Tryinputtingthis:
\documentclass{article}
\newcommand*{\fred}{Fred}
% should print ‘Fred’
% try to make it t print ‘Frederick’ instead
\renewcommand{\fred}{\fred erick}
\begin{document}
His name e is s \fred.
\end{document}
andTeXwilltellyouthatithasrunoutofstackspace:
! TeX capacity exceeded, sorry [input stack size=15000].
\fred ->\fred
erick
l.5 His s name is s \fred
.
No pages of output.
Transcript written n on errors.log.
Theoffendingcodeabovetriestodefine
\fred
intermsofitself,andTeXjustkeeps
chasingroundandroundtryingtopindown
\fred
untilitisexhausted.
At theendofthe
log
file forarun, TeXprintsthememoryspaceit hasused. . For
example:
Here is s how much h of f TeX’s memory you used:
2432 strings out of 60985
29447 string characters out t of f 4940048
106416 words of f memory out t of 8000001
5453 multiletter control sequences s out t of f 10000+65535
8933 words of font info for r 31 1 fonts out t of f 1000000 for 1000
276 hyphenation exceptions s out of f 1000
26i,11n,21p,210b,380s stack positions s out t of
15000i,4000n,6000p,200000b,40000s
456
C# PDF insert image Library: insert images into PDF in C#.net, ASP
inserting image to PDF in preview without adobe PDF reader installed. Able to zoom and crop image and achieve image resizing. Merge several images into PDF.
pdf combine pages; c# merge pdf
XDoc, XImage SDK for .NET - View, Annotate, Convert, Edit, Scan
Adobe PDF. XDoc PDF. Scanning. XImage OCR. Microsoft Office. XDoc Word. XDoc Excel. XDoc PowerPoint. Barcoding. XImage Barcode Reader. XImage Barcode Generator.
add multiple pdf files into one online; pdf merge files
F.1. TeXmessages
Theerormessagesayswhatkindofspaceitexhausted(inputstacksizeintheexample
above).Themostcommonare:
buffer size
CanbecausedbytoolongasectionorcaptiontitleappearingintheToC,
LoF,etc.Usetheoptionalargumenttoproduceashorterentry.
exception dictionary
Therearetoomanywordslistedin
\hyphenation
commands.
Removeanythatare notactuallyusedand ifthatdoesn’t work, remove theless
commononesandinsert
\-
inthewordsinthetext.
hash size
The document definestoo manycommand namesand/or usestoomany
cross-referencing
\label
s.
input stack k size
Typicallycausedbyaself-referencingmacrodefinition.
main memory size
TherearethreemainthingsthatcauseTeXtorunoutofmainmem-
ory:
 Definingalotofverylongcomplicatedmacros.
 Havingtoomany
\index
or
\glossary
commandsonapage.
 CreatingsuchacomplicatedpagethatTeXcannotholdallitneedstoprocessit.
Thesolutiontothefirsttwoproblemsistosimplifyandeliminate.Thethirdismore
problematic.
Large
tabular
s,
array
sand
picture
s(the
\qbezier
commandisamemoryhog)
cangobbleupmemory.Aqueueoffloatsalsodemandsmemoryspace.Tryputting
a
\clearpage
justbeforetheplacewheretheerroroccursandifitstillrunsoutof
roomthentheremaybeanerrorinyourfile,otherwiseyoudidexceedthecapacity.
Ifyouhavealongparagraphoralong
verbatim
environmenttrybreakingitup,
asTeXkeepstheseinmemoryuntilitisreadytotypesetthem. Ifyouhaveaqueue
offloatsmakesurethatyouhavedoneyourbesttohelpLaTeXfindawaytoout-
putthem(see§10.4)andtryadding
\clearpage
atappropriateplacestoflushthe
queue.
pool size
Typicallycausedbyhavingtoomanycharactersincommandnamesandlabel
names.
It can n also be caused by omitting the right brace that ends s the e argument t of a
countercommand(
\setcounter
or
\addtocounter
)or ofa
\newenvironment
or
\newtheorem
command.
save stack k size
Thishappensifcommandsorenvironmentsarenestedtoodeeply.
Forinstance a
picture
thatcontainsa
picture
that includesa
\multiput
that
includesa
picture
thatincludesa...
457
C# PDF: How to Create PDF Document Viewer in C#.NET with
The PDF document viewer & reader created by this C#.NET imaging toolkit can be used by developers for reliably & quickly PDF document viewing, PDF annotation
c# merge pdf files into one; best pdf combiner
C# WPF PDF Viewer SDK to view, annotate, convert and print PDF in
VB.NET File: Merge PDF; VB.NET File: Split PDF; VB.NET VB.NET Annotate: PDF Markup & Drawing. XDoc.Word for C#; C#; XImage.OCR for C#; XImage.Barcode Reader for C#
break a pdf into multiple files; all jpg to one pdf converter
F. T
HE TERRORSOFERRORS
F.2 L
A
T
E
X
ERRORS
LaTeXerrorsintroducethemselvesdifferentlyfromthosethatTeXfinds. Forexample,if
youeverhappendedtousethe
\caption
commandoutsideafloat,like:
\caption{Naked}
youwouldgetthemessage:
! LaTeX Error: \caption n outside e float.
See the e LaTeX manual or r LaTeX Companion n for explanation.
Type H H <return> > for r immediate e help.
...
l.624 \caption
{Naked}
?
Ifyouthentyped
H
inresponseyouwouldgetthefollowinghelpfulmessage:
You’re in n trouble e here. . Try y typing g <return> > to proceed.
If that doesn’t t work, , type X X <return> > to quit.
?
ThemajorityofLaTeX’shelpmessagesfollowthisformula,soIhavenotnotedthemin
thealphabeticallistingbelow.
\< in n mid line
A
\<
appearsinthemiddleofalineina
tabbing
environment;itshouldonlycome
atthestartofaline.
... allowed d only in n math mode
Youhavetriedtouseamathcommandinanon-mathmode.
Bad \line or r \vector r argument
A
\line
or
\vector
hasanegativelengthargumentortheslopeisnotwithinthe
allowedrange.
Bad math environment delimeter
Ifinmathmodethereisastartmathmodecommandlike
\(
or
\[
orifinLRorpara-
graphmodethereisanendmathmodecommandlike
\)
or
\]
.Thebasicproblemis
unmatchedmathmodedelimetersorunbalancedbraces.
\begin{...} ended d by y \end{...}
Thenameofthe
\begin
argumentisnotthesameasthenameofthe
\end
argument.
Thiscouldbecausedbyatypooramissing
\end
.
Can only be used in the preamble
Somecommandscanonlybeusedinthepreamble,suchas
\usepackage
,butthere
wasoneoftheseafterthe
\begin{document}
.
458
F.2. LaTeXerrors
\caption outside float
Youhaveusedthe
\caption
commandoutsideafloat,suchasa
figure
or
table
environment.
Command \... . already y defined d or r name \end... . illegal
Thisisnormallybecauseyouhaveusedoneofthe
\new...
commandstodefinea
commandorenvironmentorcounternamethathasalreadybeenused; remember
alsothatdefininganenvironment
foo
automaticallydefinesthemacro
\foo
.Either
chooseanewnameorusetheappropriate
\renew...
;also,see§19.1.Intheunlikely
eventthatyouhavetriedtodefinesomethingbeginningwith
\end...
,choosean-
othername.
Command ... . invalid d in math mode
Youhaveusedanon-mathcommandinmathmode.
Command ... . not t provided in base LaTeX2e
YouhavetriedtouseasymbolthatisnotpartofbasicLaTeX.Tryloadingthela-
texsymoramsfontspackagewhichmightdefinethesymbol.
Counter too large
Youareusinganon-numericcounterrepresentation,suchaslettersorfootnotesym-
bols,andthecounterhasexceededtheallowednumber(forexamplethereareonly
26alphabeticcharacters).
Environment ... . undefined
LaTeXdoesnotknowthenameoftheargumentofa
\begin
. Youhaveprobably
misspelledit.
File not t found. . Type e X to quit or r <RETURN> > to proceed d or r enter new
name (Default t extension: : ...)
LaTeXcannotfindthefileyourequested.Theextension
tex
resultsfromaproblem-
atic
\input
or
\include
;theextension
sty
froma
\usepackage
andanextension
cls
froma
\documentclass
.
Float(s) lost
Usuallycausedbyhavingtoomany
\marginpar
sonapage.
Illegal character in array argument
Thereisanillegalcharacterintheargumentofan
array
or
tabular
environment,
orinthesecondargumentofa
\multicolumn
command.
\include cannot be nested
Afilethatis
\include
dcannot
\include
anyotherfiles.
\LoadClass in package file
Thisisanerrorinapackagefileyouareusing(youcanonlyuse
\LoadClass
ina
classfile).Complaintotheauthor.
459
F. T
HE TERRORSOFERRORS
Lonely \item m –- - perhaps a missing list environment
An
\item
commandappearstobeoutsideanylistenvironment.
Missing \begin{document}
Ifyouhaven’tforgotten
\begin{document}
thenthereissomethingwronginthe
preambleasLaTeXistryingtotypesetsomethingbeforethedocumentstarts.Thisis
oftencausedbymissingthebackslashfromacommand,misplacedbracesroundan
argument,astraycharacter,orsuchlike.
Missing @-exp p in array y argument
The
@
characterisnotfollowedbyan@-expressionintheargumentofan
array
or
tabular
environment,orinthesecondargumentofa
\multicolumn
command.
Missing p-arg g in array y argument
Thereisa
p
notfollowedbybracesintheargumentofan
array
or
tabular
envi-
ronment,orinthesecondargumentofa
\multicolumn
command.
No counter r ... . defined
Theargumenttoa
\setcounter
or
\addtocounter
command,orintheoptional
argumentto
\newcounter
or
\newtheorem
isnotthenameofacounter. Perhaps
youmisspelledthename.However,iftheerroroccuredwhilean
aux
filewasbeing
readthenyoumightwellhaveuseda
\newcounter
inan
\include
dfile.
No room for r a new w ...
TeXislimitedinthenumbersofdifferentthingsitcanhandle.Youmightnotrecog-
nizethethingthatthemessagementionsassomeofthemarehiddeninLaTeX.The
LaTeX
counter
usesaTeX
\count
forexample,andalengthisaTeX
\skip
.Most
thingsarelimitedtoamaximumof256buttherecanbenomorethan16filesopen
forreadingand16forwriting.
No \title e given
Youdidnotputa
\title
commandbeforeusing
\maketitle
.
Not in outer r par r mode
Thereisafloat(e.g.,a
figure
ora
\marginpar
)inmathmodeorinaparbox(e.g.,
inanotherfloat).
Option clash h for r ...
Thesamepackagewasusedtwicebutwithdifferentoptions. Itispossibleforone
packagetouseanotherpackagewhichmightbethecauseifyoucan’tseeanything
obvious.
Page height already too large
Youaretryingtouse
\enlargethispage
whenthepageisalreadytoolarge.
\pushtabs and \poptabs s don’t t match
Thereareunmatched
\pushtabs
and
\poptabs
ina
tabbing
environment.
460
F.2. LaTeXerrors
\RequirePackage or \LoadClass s in n Options Section
Thisisaprobleminaclassorpackagefile.Complaintotheauthor.
Something’s wrong –- perhaps a missing \item
Thiscan be e caused by y not t startinga a list t environment, , such as
itemize
witha
\item
command,orbyomittingtheargumenttothe
thebibliography
environ-
ment. Therearemanyothernon-obviouscauses,suchascallingsomemacrothat
endsupusing
\addvspace
or
\addpenalty
whennotin
vmode
.
Suggested extra a height (...) ) dangerously y large
LaTeXisconcernedthatyouatryingtoincreasethe pagesizetoomuchwiththe
\enlargthispage
command.
Tab overflow
Inthe
tabbing
environmenta
\=
hasexceededLaTeX’smaximumnumberoftab
stops.
The file needs s format t ... . but t this is ...
The documentusesadocument classor package thatisnot compatiblewiththe
versionofLaTeXyouareusing. Ifyouareusingonlystandardfilesthenthereisa
problemwithyourLaTeXinstallation.
There’s no line to end here
A
\newline
or
\\
appearsinverticalmode,forexamplebetweenparagraphs. Or
perhapsyouhavetriedtoput
\\
immediatelyafteran
\item
tostartthetextona
newline.Ifthisisthecase,thentrythis:
\item \mbox{} \\
...
This may y be a LaTeX X bug
Thisisamessageyoudon’twanttoseeasitisproducedbytheoutputroutine—
perhapsthemostobscurepartofLaTeX.Itisprobablyduetoanearliererror.Ifitis
thefirsterror,though,andyoucan’tseeanythingwrong,askforsomebody’shelp.
Too deeply nested
Therearetoomanylistenvironmentsnestedwithineachother. Atleastfourlevels
areusuallyavailablebutsomelistenvironmentsarenotobvious(forexamplethe
quotation
environmentisactuallyalist).
Too many columns in n eqnarray y environment
An
eqnarray
environmenthasthree
&
columnseparatorswithno
\\
between.
Too many unprocessed floats
Theremaybetoomany
\marginpar
stofitonapage,butit’smorelikelythatLaTeX
hasn’tbeenabletofindlocationsforprintingallthefiguresortables. Ifonefloat
cannotbeplaced,alllateronesaresaveduntilLaTeXrunsoutofstoragespace.See
§10.4fordetailsonhowLaTeXdecidestoplaceafloat.
461
F. T
HE TERRORSOFERRORS
Two \documentclass commands
Yourdocumenthastwo
\documentclass
commands;onlyoneispermitted.
Two \LoadClass commands
Thisisanerrorintheclassfile.Complaintotheauthor.
Undefined tab position
A
\>
,
\+
,
\-
,or
\<
tabbingcommandistryingtomovetoatabpositionthathasnot
beendefinedbya
\=
command.
Unknown option n ... . for r class/package e ...
Youhaveaskedforanoptionthattheclassorpackagedoesnotknowabout.Perhaps
youhavemispelledsomething,oromittedacomma.
\usepackage before \documentclass
Ingeneral,the
\usepackage
commandcanonlybeusedinthepreamble.
\verb ended by end of line
Theargumentofa
\verb
commandrunspasttheendoftheline.Perhapsyouforgot
toputinthecorrectendingcharacter.
\verb illegal in command argument
A
\verb
cannotbepartoftheargumenttoanothercommand.
F.3 L
A
T
E
X
WARNINGS
Mostwarningsaregivenatthepointinthedocumentwhereapotentialproblemisdis-
covered,whileothersareoutputafterthedocumenthasbeenprocessed.
Forexample,thefollowingcode
... \ref{joe}... \cite{FRED96} } ...
mayproducewarningslike
Latex Warning: Reference ‘joe’ on page 12 2 undefined
on input t line 881.
Latex Warning: Citation n ‘FRED96’ ’ on n page e 12 undefined
at lines s 890--897.
duringthedocumentprocessing,andthenattheendtherewillalsobethewarning:
LaTeX Warning: There were undefined d references.
Somewarningmessagespinpointwhereaproblemmightlie,asinthecitationwarning
above,whileothersmakenoattempttodoso.InthealphabeticallistingthatfollowsIhave
notincludedsuchinformation,evenifitissupplied.
Citation ... . on n page ... . undefined
Thekeyina
\cite
commandwasnotdefinedbyany
\bibitem
.
462
Documents you may be interested
Documents you may be interested