how to view pdf file in asp.net c# : Extract images from pdf acrobat software SDK dll winforms wpf web page web forms cips2ed27-part1024

16.3. STEREOGRAM ALGORITHMS
249
0 -> R
1 -> E
2 -> P
3 -> G
4 -> G
5 -> X
6 -> R
7 -> P
8 -> N
9 -> R
Figure 16.8: Substitution Values for the First Line of Figures 16.6 and 16.7
16.3 Stereogram Algorithms
The next three gures give the algorithms for turning a depth image into a
random dot or character stereogram. Figure 16.10shows the main processing
loop. These 12 steps repeat for every line in the depth le. In step 2, initialize
the pattern according tothepattern length. If the pattern length is 100, place
0through 99 (just one time) in the pattern array. Steps 4 through 8 loop
through each element or pixel in a depth line. The values of this
pixel and
last
pixel cause the pattern to grow or shrink. We perform the no change
(copy the current element ofthe pattern array to theprocessed pattern array)
on every pixel in the depth line. After saving this line of the processed
pattern, perform random substitution and save the result. Processing and
substitution occur line by line with each line being independent.
Figure 16.11 shows how toshorten apattern by deletingsizeelements(size
can by 1, 2, 3, etc.). First, save the input pattern array to a temp
pattern
and set new
width to the pattern width less size. Next, increase the pattern’s
index by size toskip over those elements todelete. Steps 4 through 6 copy the
temp
pattern back to the pattern with index skipping over elements. Step 7
shortens the current pattern width.
Figure 16.12 shows how to lengthen a pattern by inserting size elements.
First, copy the pattern to a temp
pattern and empty the pattern. Then,
put the new element(s) at the front of the pattern, increase the width, and
copy the old pattern onto the end of the pattern. For example, if pattern
is 0123456789, and size is 2, put AB at the start of the pattern and copy
Extract images from pdf acrobat - Select, copy, paste PDF images in C#.net, ASP.NET, MVC, Ajax, WinForms, WPF
Support PDF Image Extraction from a Page, a Region on a Page, and PDF Document
extract text from image pdf file; extract image from pdf using
Extract images from pdf acrobat - VB.NET PDF Image Extract Library: Select, copy, paste PDF images in vb.net, ASP.NET, MVC, Ajax, WinForms, WPF
Support PDF Image Extraction from a Page, a Region on a Page, and PDF Document
extract pictures pdf; extract image from pdf online
250
CHAPTER 16. RANDOM DOT STEREOGRAMS
000000000000000000000000000000000000
000000000000000000000000000000000000
000000000000000000000000000000000000
000000001111111111111110000000000000
000000001111111111111110000000000000
000000001111111111111110000000000000
000000001111111111111110000000000000
000000001111111112222222222222220000
000000001111111112222222222222220000
000000001111111112222222222222220000
000000000000000002222222222222220000
000000000000000002222222222222220000
000000000000000002222222222222220000
000000000000000002222222222222220000
000000000000000002222222222222220000
000000000000000000000000000000000000
000000000000000000000000000000000000
000000000000000000000000000000000000
REPGGXRPNRREPGGXRPNRREPGGXRPNRREPGGX
BZCNFWLQIJBZCNFWLQIJBZCNFWLQIJBZCNFW
JBBHAWDYDCJBBHAWDYDCJBBHAWDYDCJBBHAW
WSJRXJHGZWSJRXJHGZWSJRXYJHGZWSJRXYJH
AJQKCKLZAAJQKCKLZAAJQKCYKLZAAJQKCYKL
SSQCTYDTASSQCTYDTASSQCTMYDTASSQCTMYD
EDRWUDXZFEDRWUDXZFEDRWUUDXZFEDRWUUDX
RIFSUQHCSRIFSUQHCRIFSUQHCRIFSUQHKMCR
HRWTFDUKFHRWTFDUKHRWTFDUKHRWTFDUFJKH
ZPDPYZKZVZPDPYZKZZPDPYZKZZPDPYZKBNZZ
ISFRFQGVPMISFRFQGMISFRFQGMISFRFQVOGM
KLASOLWJXPKLASOLWPKLASOLWPKLASOLTXWP
WEAAFJEQIOWEAAFJEOWEAAFJEOWEAAFJZPEO
WXFAIGAYRUWXFAIGAUWXFAIGAUWXFAIGEIAU
JKZTVJGKWXJKZTVJGXJKZTVJGXJKZTVJKEGX
LRAXGLMTBILRAXGLMTBILRAXGLMTBILRAXGL
BDDNDODXEUBDDNDODXEUBDDNDODXEUBDDNDO
CKVRJBFRJPCKVRJBFRJPCKVRJBFRJPCKVRJB
Figure 16.9: A Depth Image and Random Character Stereogram Image
.NET PDF Document Viewing, Annotation, Conversion & Processing
Extract hyperlink inside PDF. PDF Write. Redact text content, images, whole pages from PDF file. Edit, update, delete PDF annotations from PDF file. Print.
extract pdf images; how to extract text from pdf image file
C# PDF Converter Library SDK to convert PDF to other file formats
other external third-party dependencies like Adobe Acrobat. NET supports file conversion between PDF and various documents and images, like Microsoft
extract images from pdf acrobat; how to extract images from pdf in acrobat
16.3. STEREOGRAM ALGORITHMS
251
1. Read a line from the depth file
2. Initialize the pattern
3. last_pixel = depth_line[0]
4. Loop through the depth_line j=0, width
5. this_pixel = depth_line[j]
6. If this_pixel > last_pixel
shorten the pattern
7. If this_pixel < last_pixel
lengthen the pattern
8. Perform no change to the pattern
9. Save the processed pattern
10. Perform random substitution
11. Save the random pattern
12. go back to 1 until you’ve read the entire depth file
Figure 16.10: The Stereogram Processing Loop
C# Windows Viewer - Image and Document Conversion & Rendering in
in .NET class applications independently, without using other external third-party dependencies like Adobe Acrobat. Convert to PDF. Convert to Various Images.
extract vector image from pdf; how to extract a picture from a pdf
C# powerpoint - PowerPoint Conversion & Rendering in C#.NET
without using other external third-party dependencies like Adobe Acrobat. 2003, 2007 and above versions, raster images (Jpeg, Png PowerPoint to PDF Conversion.
extract image from pdf c#; extract images from pdf c#
252
CHAPTER 16. RANDOM DOT STEREOGRAMS
1. Copy the pattern to a temp_pattern
2. new_width = cuurent_width - size
3. index = (index + size) modulus current_width
4. Loop for new_index = 0,new_width
5. pattern[new_index] = temp_pattern[index]
6. index = (index + 1) modulus current_width
7. current_width = new_width
8. index = 0
Figure 16.11: The Shorten Pattern Algorithm
0123456789 onto the end producing AB1234567890. The max
width variable
points to the last element added to the pattern (’B’ in this example). The
next time we insert an element into the pattern, max
width will tell us to
add a ’C’, then a ’D’, and so on.
16.4 Source Code and Examples
Listing 16.1 shows the source code for the cstereo program that makes ran-
dom character stereograms like is gure 16.9. The depth, processed pattern,
and stereogram images are kept in text les so all I/O is with fgets and
fputs. The main while processing loop implements the algorithm of gure
16.10, and the functions shorten
pattern and lengthen
pattern do the same
for gures 16.11 and 16.12. The other functions are straightforward. Note
how the function get
random
values contains several dierent ways (ifdef’ed
out) to produce random substitution values.
Run cstereo with a command line like:
cstereo 10 36 dle.txt sle.txt pple.txt
where 10 is the pattern width, 36 the width of the text in the les, and the
C# Word - Word Conversion in C#.NET
without using other external third-party dependencies like Adobe Acrobat. document, including Jpeg, Png, Bmp, Gif images, .NET Graphics PDF to Word Conversion.
extract jpg from pdf; pdf image extractor online
JPEG to PDF Converter | Convert JPEG to PDF, Convert PDF to JPEG
Features and Benefits. Powerful image converter to convert images of JPG, JPEG formats to PDF files; No need for Adobe Acrobat Reader; Seamlessly integrated into
pdf image extractor c#; extract images from pdf online
16.4. SOURCE CODE AND EXAMPLES
253
1. Copy pattern to a temp_pattern
2. Blank out the pattern
3. Put ’size’ new elements in pattern
4. new_width = current_width + size
5. Copy temp_pattern onto the end of pattern
6. current_width = current_width + size
7. max_width = max_width + size
8. index = 0
Figure 16.12: The Lengthen Pattern Algorithm
remaining parameters the names of the depth, stereogram, and processed
pattern les.
Listing 16.2 shows the source code for the pstereo program that makes
random dot stereograms and places them in gray scale image les. This
program and cstereo are the same except for the type of data they process.
pstereo uses the image I/O routines used by the other image processing pro-
grams in this text.
Run pstereo with a command line like:
pstereo 100 dle.tif sle.tif pple.tif
Figure 16.13 is a gray scale depth le. The background is at level 0 while the
squares are at levels 2, 4, 5, and 8. Figure 16.14 is a random dot stereogram
that pstereo produced from Figure 16.13 using a pattern length of 100. The
image is 400x400 pixels printed at 4"x4" so the pattern length of 100 pixels
translates to 1".
There areseveral ways to create depth les. Commercial paint and graph-
ics programs can generate gray scale TIFF les. Use these to set the back-
ground to all black (0) and the objects to other levels. Take care as some
programs make gray shades by setting black pixels next to white ones. These
do not work well. I use the pattern program discussed brie y earlier in this
PDF to WORD Converter | Convert PDF to Word, Convert Word to PDF
No need for Adobe Acrobat and Microsoft Word; Has built-in wizard to guide your Open PDF to Word Convert first; Load PDF images from local folders in "File" in
some pdf image extractor; extract photos from pdf
C# Excel - Excel Conversion & Rendering in C#.NET
without using other external third-party dependencies like Adobe Acrobat. PPT) 2003, 2007 and above versions, raster images (Jpeg, Png Excel to PDF Conversion.
extract photos pdf; extract jpg pdf
254
CHAPTER 16. RANDOM DOT STEREOGRAMS
Figure 16.13: A Simple Depth File Image
GIF to PDF Converter | Convert GIF to PDF, Convert PDF to GIF
and convert PDF files to GIF images with high quality. It can be functioned as an integrated component without the use of external applications & Adobe Acrobat
pdf image extractor c#; extract vector image from pdf
DICOM to PDF Converter | Convert DICOM to PDF, Convert PDF to
organized interface, allowing users to convert DICOM (DICOM) images to, from PDF documents with converters, users do not need to load Adobe Acrobat or any
extract image from pdf in; extract image from pdf online
16.4. SOURCE CODE AND EXAMPLES
255
Figure 16.14: A Random Dot Stereogram from Figure 16.13
256
CHAPTER 16. RANDOM DOT STEREOGRAMS
book.
Figure 16.15 is another random dot stereogram. What’s in it?
Figure 16.15: A Random Dot Stereogram
16.5 Coloreld Stereograms
Apopular variation of the random dot stereograms presented above is the
coloreld stereogram. Instead ofreplacingthe processed pattern with random
substitutions, coloreld stereograms use special patterns from a coloreld.
Figure 16.16 shows a coloreld image. It has a boy image repeated over
and again. The boy image is a special pattern that will make up the sub-
stitutions when creating a stereogram. There is nothing special about the
the boy image. What matters is that it has a set width like the 0 through 9
sequence shown earlier.
16.5. COLORFIELD STEREOGRAMS
257
Figure 16.16: A \Coloreld" Image of Boys
258
CHAPTER 16. RANDOM DOT STEREOGRAMS
Coloreld stereograms are dierent when the stereogram procedure calls
for lengthening the pattern tocreate the illusion of depth. Items added to the
pattern must come from the special pattern | the boy in this case. Figure
16.17 shows a resulting stereogram taken from Figure 16.16.
Figure 16.17: A Coloreld Stereogram from Figure 16.16
Figures 16.18 through 16.19 show another colored stereogram example.
Figure 16.18 is the input special pattern image. Figure 16.19 is the input
depth le, and Figure 16.20 is the nal result.
Coloreld stereograms contain the same constraints as random dot stere-
ograms. The pattern width (here the width of the boy and the width of the
house) must be a little less than the distance between the viewer’s eyes. The
creator must consider the output device and the dots per inch in the image,
etc.
The principles of coloreld stereograms also apply to the character stere-
ograms shown earlier. Figure 16.21 shows a simple depth le. Figure 16.22
shows the nal result of a character coloreld stereogram. This example used
Documents you may be interested
Documents you may be interested